PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_FE8B8ABC4.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 191aa    MW: 21363.3 Da    PI: 8.0856
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_FE8B8ABC4.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-172875148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT +Ed+ l+++++ +G g+W++ ar  g++Rt+k+c++rw++yl
  Traes_4BL_FE8B8ABC4.1 28 RGPWTVDEDLTLINYIADHGEGRWNALARAAGLRRTGKSCRLRWLNYL 75
                           89********************************************97 PP

2Myb_DNA-binding30.58.4e-1081124146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg++T++E++l++d++ ++G++        ++ gRt++++k++w++
  Traes_4BL_FE8B8ABC4.1  81 RGNFTADEQLLILDLHSRWGNR-XXXXXXXLP-GRTDNEIKNYWRT 124
                            89********************.88889****.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.5562379IPR017930Myb domain
SuperFamilySSF466891.17E-2626122IPR009057Homeodomain-like
SMARTSM007171.1E-142777IPR001005SANT/Myb domain
PfamPF002494.0E-162875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-232982IPR009057Homeodomain-like
CDDcd001673.75E-123075No hitNo description
PROSITE profilePS5129410.16380130IPR017930Myb domain
SMARTSM007178.6E-680128IPR001005SANT/Myb domain
PfamPF002492.4E-781124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-1783129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MASVTEDPAV RSSNSMAAEP EEEAELRRGP WTVDEDLTLI NYIADHGEGR WNALARAAGL  60
RRTGKSCRLR WLNYLRPDVK RGNFTADEQL LILDLHSRWG NRXXXXXXXL PGRTDNEIKN  120
YWRTRVQKHA KQLNCDVGSA TFKDAMRYLW MPHLVERIHA AAATAGGDPT MGDTSCASGV  180
TSMAATATTY P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-232512224120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0090181e-135BT009018.1 Triticum aestivum clone wdk3c.pk006.n12:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618000.16e-93PREDICTED: transcription factor MYB108
SwissprotQ9LDE15e-70MY108_ARATH; Transcription factor MYB108
TrEMBLW5E8P51e-134W5E8P5_WHEAT; Uncharacterized protein
STRINGLOC_Os11g45740.12e-92(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-62myb domain protein 78
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]